![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
![]() | Protein UDP-glucose dehydrogenase (UDPGDH) [51877] (1 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [51878] (2 PDB entries) |
![]() | Domain d1dlja2: 1dlj A:1-196 [30212] Other proteins in same PDB: d1dlja1, d1dlja3 complexed with gol, nai, so4, uga |
PDB Entry: 1dlj (more details), 1.8 Å
SCOPe Domain Sequences for d1dlja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} mkiavagsgyvglslgvllslqnevtivdilpskvdkinnglspiqdeyieyylkskqls ikatldskaaykeaelviiatptnynsrinyfdtqhvetvikevlsvnshatliikstip igfitemrqkfqtdriifspeflreskalydnlypsriivsceendspkvkadaekfall lksaakknnvpvlimg
Timeline for d1dlja2: