Lineage for d1dlja2 (1dlj A:1-196)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2453360Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 2453536Protein UDP-glucose dehydrogenase (UDPGDH) [51877] (1 species)
  7. 2453537Species Streptococcus pyogenes [TaxId:1314] [51878] (2 PDB entries)
  8. 2453538Domain d1dlja2: 1dlj A:1-196 [30212]
    Other proteins in same PDB: d1dlja1, d1dlja3
    complexed with gol, nai, so4, uga

Details for d1dlja2

PDB Entry: 1dlj (more details), 1.8 Å

PDB Description: the first structure of udp-glucose dehydrogenase (udpgdh) reveals the catalytic residues necessary for the two-fold oxidation
PDB Compounds: (A:) udp-glucose dehydrogenase

SCOPe Domain Sequences for d1dlja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]}
mkiavagsgyvglslgvllslqnevtivdilpskvdkinnglspiqdeyieyylkskqls
ikatldskaaykeaelviiatptnynsrinyfdtqhvetvikevlsvnshatliikstip
igfitemrqkfqtdriifspeflreskalydnlypsriivsceendspkvkadaekfall
lksaakknnvpvlimg

SCOPe Domain Coordinates for d1dlja2:

Click to download the PDB-style file with coordinates for d1dlja2.
(The format of our PDB-style files is described here.)

Timeline for d1dlja2: