Lineage for d3hdhc2 (3hdh C:12-203)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20614Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (6 proteins)
  6. 20642Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [51874] (2 species)
  7. 20656Species Pig (Sus scrofa) [TaxId:9823] [51876] (1 PDB entry)
  8. 20659Domain d3hdhc2: 3hdh C:12-203 [30211]
    Other proteins in same PDB: d3hdha1, d3hdhb1, d3hdhc1

Details for d3hdhc2

PDB Entry: 3hdh (more details), 2.8 Å

PDB Description: pig heart short chain l-3-hydroxyacyl coa dehydrogenase revisited: sequence analysis and crystal structure determination

SCOP Domain Sequences for d3hdhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hdhc2 c.2.1.6 (C:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Pig (Sus scrofa)}
kilvkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
enpkagdefvektlssiststdaasvvhstdlvveaivenlkvkselfkrldkfaaehti
fasntsslqitslanattrqdrfaglhffnpvplmklvevvktpmtsqktleslvdfskt
lgkhpvsckdtp

SCOP Domain Coordinates for d3hdhc2:

Click to download the PDB-style file with coordinates for d3hdhc2.
(The format of our PDB-style files is described here.)

Timeline for d3hdhc2: