Lineage for d3hdhc2 (3hdh C:12-203)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844998Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 2845146Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [51874] (2 species)
  7. 2845170Species Pig (Sus scrofa) [TaxId:9823] [51876] (1 PDB entry)
  8. 2845173Domain d3hdhc2: 3hdh C:12-203 [30211]
    Other proteins in same PDB: d3hdha1, d3hdhb1, d3hdhc1
    complexed with nad

Details for d3hdhc2

PDB Entry: 3hdh (more details), 2.8 Å

PDB Description: pig heart short chain l-3-hydroxyacyl coa dehydrogenase revisited: sequence analysis and crystal structure determination
PDB Compounds: (C:) protein (l-3-hydroxyacyl coa dehydrogenase)

SCOPe Domain Sequences for d3hdhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hdhc2 c.2.1.6 (C:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
kilvkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
enpkagdefvektlssiststdaasvvhstdlvveaivenlkvkselfkrldkfaaehti
fasntsslqitslanattrqdrfaglhffnpvplmklvevvktpmtsqktleslvdfskt
lgkhpvsckdtp

SCOPe Domain Coordinates for d3hdhc2:

Click to download the PDB-style file with coordinates for d3hdhc2.
(The format of our PDB-style files is described here.)

Timeline for d3hdhc2: