| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
| Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [51874] (2 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [51876] (1 PDB entry) |
| Domain d3hdhc2: 3hdh C:12-203 [30211] Other proteins in same PDB: d3hdha1, d3hdhb1, d3hdhc1 complexed with nad |
PDB Entry: 3hdh (more details), 2.8 Å
SCOPe Domain Sequences for d3hdhc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hdhc2 c.2.1.6 (C:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
kilvkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
enpkagdefvektlssiststdaasvvhstdlvveaivenlkvkselfkrldkfaaehti
fasntsslqitslanattrqdrfaglhffnpvplmklvevvktpmtsqktleslvdfskt
lgkhpvsckdtp
Timeline for d3hdhc2:
View in 3DDomains from other chains: (mouse over for more information) d3hdha1, d3hdha2, d3hdhb1, d3hdhb2 |