![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) ![]() |
![]() | Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (6 proteins) |
![]() | Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [51874] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [51876] (1 PDB entry) |
![]() | Domain d3hdha2: 3hdh A:12-203 [30209] Other proteins in same PDB: d3hdha1, d3hdhb1, d3hdhc1 |
PDB Entry: 3hdh (more details), 2.8 Å
SCOP Domain Sequences for d3hdha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hdha2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Pig (Sus scrofa)} kilvkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa enpkagdefvektlssiststdaasvvhstdlvveaivenlkvkselfkrldkfaaehti fasntsslqitslanattrqdrfaglhffnpvplmklvevvktpmtsqktleslvdfskt lgkhpvsckdtp
Timeline for d3hdha2:
![]() Domains from other chains: (mouse over for more information) d3hdhb1, d3hdhb2, d3hdhc1, d3hdhc2 |