Lineage for d1f12a2 (1f12 A:12-203)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844998Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 2845146Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [51874] (2 species)
  7. 2845147Species Human (Homo sapiens) [TaxId:9606] [51875] (11 PDB entries)
  8. 2845158Domain d1f12a2: 1f12 A:12-203 [30207]
    Other proteins in same PDB: d1f12a1, d1f12a3, d1f12b1
    complexed with 3hc

Details for d1f12a2

PDB Entry: 1f12 (more details), 2.4 Å

PDB Description: l-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa
PDB Compounds: (A:) l-3-hydroxyacyl-coa dehydrogenase

SCOPe Domain Sequences for d1f12a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f12a2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
enpkagdecvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti
fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
lgkhpvsckdtp

SCOPe Domain Coordinates for d1f12a2:

Click to download the PDB-style file with coordinates for d1f12a2.
(The format of our PDB-style files is described here.)

Timeline for d1f12a2: