Lineage for d1f14b2 (1f14 B:12-203)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66886Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (6 proteins)
  6. 66914Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [51874] (2 species)
  7. 66915Species Human (Homo sapiens) [TaxId:9606] [51875] (6 PDB entries)
  8. 66923Domain d1f14b2: 1f14 B:12-203 [30206]
    Other proteins in same PDB: d1f14a1, d1f14b1

Details for d1f14b2

PDB Entry: 1f14 (more details), 2.3 Å

PDB Description: l-3-hydroxyacyl-coa dehydrogenase (apo)

SCOP Domain Sequences for d1f14b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f14b2 c.2.1.6 (B:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens)}
kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
enpkagdecvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti
fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
lgkhpvsckdtp

SCOP Domain Coordinates for d1f14b2:

Click to download the PDB-style file with coordinates for d1f14b2.
(The format of our PDB-style files is described here.)

Timeline for d1f14b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f14b1