SCOPe 2.08: Domain d5dfwh2: 5dfw H:501-810

Lineage for d5dfwh2 (5dfw H:501-810)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5dfwh2: 5dfw H:501-810 [302057]
   Other proteins in same PDB: d5dfwa1, d5dfwa2
   automated match to d1dzba2

Details for d5dfwh2

PDB Entry: 5dfw, 2.33 Å

PDB Description: crystal structure of human cd81 large extracellular loop in complex with single chain fv fragment k13

PDB Compounds: (H:) single chain fv fragment

SCOPe Domain Sequences for d5dfwh2:

Sequence; same for both SEQRES and ATOM records:

>d5dfwh2 b.1.1.0 (H:501-810) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspaslsvsvgetvtitcraseniyrtlawylqkqgkspqllvygattladgvps
rfsgsgsgtqyylkinslqsedfgtyhcqhfwgtpwtfgggtkveik

Timeline for d5dfwh2:

• d5dfwh2 first appeared in SCOPe 2.06
  
• d5dfwh2 appears in SCOPe 2.07