SCOPe 2.08: Domain d5dcxa1: 5dcx A:1-214

Lineage for d5dcxa1 (5dcx A:1-214)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
   alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325

4. Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families)

5. Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (2 proteins)
   automatically mapped to Pfam PF08724

6. Protein automated matches [277252] (2 species)
   not a true protein

7. Species Adeno-associated virus 2 [TaxId:10804] [277253] (1 PDB entry)

8. Domain d5dcxa1: 5dcx A:1-214 [302044]
   Other proteins in same PDB: d5dcxa2, d5dcxb2
   automated match to d5dcxb_
   complexed with mg

Details for d5dcxa1

PDB Entry: 5dcx, 2.6 Å

PDB Description: structural studies of aav2 rep68 reveal a partially structured linker and compact domain conformation

PDB Compounds: (A:) Protein Rep68

SCOPe Domain Sequences for d5dcxa1:

Sequence, based on SEQRES records:

>d5dcxa1 d.89.1.3 (A:1-214) automated matches {Adeno-associated virus 2 [TaxId: 10804]}
mpgfyeivikvpsdldghlpgisdsfvnwvaekewelppdsdmdlnlieqapltvaeklq
rdfltewrrvskapealffvqfekgesyfhmhvlvettgvksmvlgrflsqirekliqri
yrgieptlpnwfavtktrngagggnkvvdesyipnyllpktqpelqwawtnmeqylsacl
nlterkrlvaqhlthvsqtqeqnkenqnpnsdap

Sequence, based on observed residues (ATOM records):

>d5dcxa1 d.89.1.3 (A:1-214) automated matches {Adeno-associated virus 2 [TaxId: 10804]}
mpgfyeivikvpsdldghlpgisdsfvnwvaekewelppdsdmdlnlieqapltvaeklq
rdfltewrrvskapealffvqfekgesyfhmhvlvettgvksmvlgrflsqirekliqri
yrgieptlpnwfavtktgnkvvdesyipnyllpktqpelqwawtnmeqylsaclnlterk
rlvaqhlthvsqtqeqnkenqnpnsdap

Timeline for d5dcxa1:

• d5dcxa1 first appeared in SCOPe 2.06
  
• d5dcxa1 appears in SCOPe 2.07