Lineage for d3hada2 (3had A:12-203)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20614Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (6 proteins)
  6. 20642Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [51874] (2 species)
  7. 20643Species Human (Homo sapiens) [TaxId:9606] [51875] (6 PDB entries)
  8. 20652Domain d3hada2: 3had A:12-203 [30203]
    Other proteins in same PDB: d3hada1, d3hadb1

Details for d3hada2

PDB Entry: 3had (more details), 2 Å

PDB Description: biochemical characterization and structure determination of human heart short chain l-3-hydroxyacyl coa dehydrogenase provide insight into catalytic mechanism

SCOP Domain Sequences for d3hada2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hada2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens)}
kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
enpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkraaehti
fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
lgkhpvsckdtp

SCOP Domain Coordinates for d3hada2:

Click to download the PDB-style file with coordinates for d3hada2.
(The format of our PDB-style files is described here.)

Timeline for d3hada2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hada1