![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
![]() | Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [51874] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [51875] (11 PDB entries) |
![]() | Domain d3hada2: 3had A:12-203 [30203] Other proteins in same PDB: d3hada1, d3hada3, d3hadb1 complexed with nad |
PDB Entry: 3had (more details), 2 Å
SCOPe Domain Sequences for d3hada2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hada2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa enpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkraaehti fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska lgkhpvsckdtp
Timeline for d3hada2: