Lineage for d1f17b2 (1f17 B:12-203)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349311Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 1349454Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [51874] (2 species)
  7. 1349455Species Human (Homo sapiens) [TaxId:9606] [51875] (11 PDB entries)
  8. 1349465Domain d1f17b2: 1f17 B:12-203 [30202]
    Other proteins in same PDB: d1f17a1, d1f17b1
    complexed with nai

Details for d1f17b2

PDB Entry: 1f17 (more details), 2.3 Å

PDB Description: l-3-hydroxyacyl-coa dehydrogenase complexed with nadh
PDB Compounds: (B:) l-3-hydroxyacyl-coa dehydrogenase

SCOPe Domain Sequences for d1f17b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f17b2 c.2.1.6 (B:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
enpkagdecvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti
fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
lgkhpvsckdtp

SCOPe Domain Coordinates for d1f17b2:

Click to download the PDB-style file with coordinates for d1f17b2.
(The format of our PDB-style files is described here.)

Timeline for d1f17b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f17b1