SCOP 1.75: Domain d2hdhb2: 2hdh B:12-203

Lineage for d2hdhb2 (2hdh B:12-203)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [51874] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51875] (11 PDB entries)

8. Domain d2hdhb2: 2hdh B:12-203 [30200]
   Other proteins in same PDB: d2hdha1, d2hdhb1
   complexed with nad

Details for d2hdhb2

PDB Entry: 2hdh, 2.2 Å

PDB Description: biochemical characterization and structure determination of human heart short chain l-3-hydroxyacyl coa dehydrogenase provide insight into catalytic mechanism

PDB Compounds: (B:) l-3-hydroxyacyl coa dehydrogenase

SCOP Domain Sequences for d2hdhb2:

Sequence; same for both SEQRES and ATOM records:

>d2hdhb2 c.2.1.6 (B:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
enpkagdefvaktlstiatstdaasvvhstdlvveaivenlkvknelfkrldkraaehti
fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
lgkhpvsckdtp

Timeline for d2hdhb2:

• d2hdhb2 first appeared (with stable ids) in SCOP 1.55
  
• d2hdhb2 appears in SCOP 1.73
  
• d2hdhb2 appears in SCOPe 2.01
  
• d2hdhb2 appears in the current release, SCOPe 2.08