Lineage for d2hdha2 (2hdh A:12-203)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 821720Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 821859Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [51874] (2 species)
  7. 821860Species Human (Homo sapiens) [TaxId:9606] [51875] (11 PDB entries)
  8. 821867Domain d2hdha2: 2hdh A:12-203 [30199]
    Other proteins in same PDB: d2hdha1, d2hdhb1

Details for d2hdha2

PDB Entry: 2hdh (more details), 2.2 Å

PDB Description: biochemical characterization and structure determination of human heart short chain l-3-hydroxyacyl coa dehydrogenase provide insight into catalytic mechanism
PDB Compounds: (A:) l-3-hydroxyacyl coa dehydrogenase

SCOP Domain Sequences for d2hdha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hdha2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
enpkagdefvaktlstiatstdaasvvhstdlvveaivenlkvknelfkrldkraaehti
fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
lgkhpvsckdtp

SCOP Domain Coordinates for d2hdha2:

Click to download the PDB-style file with coordinates for d2hdha2.
(The format of our PDB-style files is described here.)

Timeline for d2hdha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hdha1