Lineage for d5cnkc1 (5cnk C:30-507)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144140Species Human (Homo sapiens) [TaxId:9606] [189363] (10 PDB entries)
  8. 2144156Domain d5cnkc1: 5cnk C:30-507 [301973]
    Other proteins in same PDB: d5cnkc2
    automated match to d4xara_
    complexed with ggl, iod

Details for d5cnkc1

PDB Entry: 5cnk (more details), 3.15 Å

PDB Description: mglur3 with glutamate
PDB Compounds: (C:) Metabotropic glutamate receptor 3

SCOPe Domain Sequences for d5cnkc1:

Sequence, based on SEQRES records: (download)

>d5cnkc1 c.93.1.0 (C:30-507) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rreikiegdlvlgglfpinekgtgteecgrinedrgiqrleamlfaideinkddyllpgv
klgvhildtcsrdtyaleqslefvrasltkvdeaeymcpdgsyaiqeniplliagviggs
yssvsiqvanllrlfqipqisyastsaklsdksrydyfartvppdfyqakamaeilrffn
wtyvstvasegdygetgieafeqearlrnisiataekvgrsnirksydsvirellqkpna
rvvvlfmrsddsreliaaasranasftwvasdgwgaqesiikgsehvaygaitlelasqp
vrqfdryfqslnpynnhrnpwfrdfweqkfqcslqnkrnhrrvcdkhlaidssnyeqesk
imfvvnavyamahalhkmqrtlcpnttklcdamkildgkklykdyllkinftapfnpnkd
adsivkfdtfgdgmgrynvfnfqnvggkysylkvghwaetlsldvnsihwsrnsvpts

Sequence, based on observed residues (ATOM records): (download)

>d5cnkc1 c.93.1.0 (C:30-507) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rreikiegdlvlgglfpinekgtgteecgrinedrgiqrleamlfaideinkddyllpgv
klgvhildtcsrdtyaleqslefvrasliplliagviggsyssvsiqvanllrlfqipqi
syastsaklsdksrydyfartvppdfyqakamaeilrffnwtyvstvasegdygetgiea
feqearlrnisiataekvgrsnirksydsvirellqkpnarvvvlfmrsddsreliaaas
ranasftwvasdgwgaqesiikgsehvaygaitlelasqpvrqfdryfqslnpynnhrnp
wfrdfweqkfqcslqrvcdkhlaidssnyeqeskimfvvnavyamahalhkmqrtlcpnt
tklcdamkildgkklykdyllkinftapnkdadsivkfdtfgdgmgrynvfnfqnvggky
sylkvghwaetlsldvnsihwssvpts

SCOPe Domain Coordinates for d5cnkc1:

Click to download the PDB-style file with coordinates for d5cnkc1.
(The format of our PDB-style files is described here.)

Timeline for d5cnkc1:

  • d5cnkc1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5cnkc2