SCOP 1.69: Domain d1pgjb2: 1pgj B:1-178

Lineage for d1pgjb2 (1pgj B:1-178)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (14 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein 6-phosphogluconate dehydrogenase [51871] (2 species)

7. Species Trypanosoma brucei [TaxId:5691] [51873] (1 PDB entry)

8. Domain d1pgjb2: 1pgj B:1-178 [30196]
   Other proteins in same PDB: d1pgja1, d1pgjb1

Details for d1pgjb2

PDB Entry: 1pgj, 2.8 Å

PDB Description: x-ray structure of 6-phosphogluconate dehydrogenase from the protozoan parasite t. brucei

SCOP Domain Sequences for d1pgjb2:

Sequence; same for both SEQRES and ATOM records:

>d1pgjb2 c.2.1.6 (B:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei}
smdvgvvglgvmganlalniaekgfkvavfnrtyskseefmkanasapfagnlkafetme
afaaslkkprkalilvqagaatdstieqlkkvfekgdilvdtgnahfkdqgrraqqleaa
glrflgmgisggeegarkgpaffpggtlsvweeirpiveaaaakaddgrpcvtmngsg

Timeline for d1pgjb2:

• d1pgjb2 first appeared (with stable ids) in SCOP 1.55
  
• d1pgjb2 appears in SCOP 1.67
  
• d1pgjb2 appears in SCOP 1.71
  
• d1pgjb2 appears in the current release, SCOPe 2.08