Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) |
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (10 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
Protein 6-phosphogluconate dehydrogenase [51871] (2 species) |
Species Trypanosoma brucei [TaxId:5691] [51873] (1 PDB entry) |
Domain d1pgjb2: 1pgj B:1-178 [30196] Other proteins in same PDB: d1pgja1, d1pgjb1 complexed with so4 |
PDB Entry: 1pgj (more details), 2.8 Å
SCOP Domain Sequences for d1pgjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pgjb2 c.2.1.6 (B:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei} smdvgvvglgvmganlalniaekgfkvavfnrtyskseefmkanasapfagnlkafetme afaaslkkprkalilvqagaatdstieqlkkvfekgdilvdtgnahfkdqgrraqqleaa glrflgmgisggeegarkgpaffpggtlsvweeirpiveaaaakaddgrpcvtmngsg
Timeline for d1pgjb2: