Lineage for d1pgja2 (1pgj A:1-178)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 309007Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (12 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 309008Protein 6-phosphogluconate dehydrogenase [51871] (2 species)
  7. 309015Species Trypanosoma brucei [TaxId:5691] [51873] (1 PDB entry)
  8. 309016Domain d1pgja2: 1pgj A:1-178 [30195]
    Other proteins in same PDB: d1pgja1, d1pgjb1

Details for d1pgja2

PDB Entry: 1pgj (more details), 2.8 Å

PDB Description: x-ray structure of 6-phosphogluconate dehydrogenase from the protozoan parasite t. brucei

SCOP Domain Sequences for d1pgja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei}
smdvgvvglgvmganlalniaekgfkvavfnrtyskseefmkanasapfagnlkafetme
afaaslkkprkalilvqagaatdstieqlkkvfekgdilvdtgnahfkdqgrraqqleaa
glrflgmgisggeegarkgpaffpggtlsvweeirpiveaaaakaddgrpcvtmngsg

SCOP Domain Coordinates for d1pgja2:

Click to download the PDB-style file with coordinates for d1pgja2.
(The format of our PDB-style files is described here.)

Timeline for d1pgja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pgja1