Lineage for d1pgja2 (1pgj A:1-178)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20614Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (6 proteins)
  6. 20615Protein 6-phosphogluconate dehydrogenase [51871] (2 species)
  7. 20622Species Trypanosoma brucei [TaxId:5691] [51873] (1 PDB entry)
  8. 20623Domain d1pgja2: 1pgj A:1-178 [30195]
    Other proteins in same PDB: d1pgja1, d1pgjb1

Details for d1pgja2

PDB Entry: 1pgj (more details), 2.8 Å

PDB Description: x-ray structure of 6-phosphogluconate dehydrogenase from the protozoan parasite t. brucei

SCOP Domain Sequences for d1pgja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei}
smdvgvvglgvmganlalniaekgfkvavfnrtyskseefmkanasapfagnlkafetme
afaaslkkprkalilvqagaatdstieqlkkvfekgdilvdtgnahfkdqgrraqqleaa
glrflgmgisggeegarkgpaffpggtlsvweeirpiveaaaakaddgrpcvtmngsg

SCOP Domain Coordinates for d1pgja2:

Click to download the PDB-style file with coordinates for d1pgja2.
(The format of our PDB-style files is described here.)

Timeline for d1pgja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pgja1