Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
Protein 6-phosphogluconate dehydrogenase [51871] (2 species) |
Species Sheep (Ovis orientalis aries) [TaxId:9940] [51872] (5 PDB entries) |
Domain d1pgqa2: 1pgq A:1-176 [30194] Other proteins in same PDB: d1pgqa1 complexed with 2am, so4 |
PDB Entry: 1pgq (more details), 3.17 Å
SCOPe Domain Sequences for d1pgqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pgqa2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvlgahsleem vsklkkprriillvkagqavdnfieklvplldigdiiidggnseyrdtmrrcrdlkdkgi lfvgsgvsggedgarygpslmpggnkeawphikaifqgiaakvgtgepccdwvgdd
Timeline for d1pgqa2: