Lineage for d1pgq_2 (1pgq 1-176)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66886Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (6 proteins)
  6. 66887Protein 6-phosphogluconate dehydrogenase [51871] (2 species)
  7. 66888Species Sheep (Ovis orientalis aries) [TaxId:9940] [51872] (5 PDB entries)
  8. 66893Domain d1pgq_2: 1pgq 1-176 [30194]
    Other proteins in same PDB: d1pgq_1

Details for d1pgq_2

PDB Entry: 1pgq (more details), 3.17 Å

PDB Description: crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for nadp specificity and the enzyme mechanism

SCOP Domain Sequences for d1pgq_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgq_2 c.2.1.6 (1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries)}
aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvlgahsleem
vsklkkprriillvkagqavdnfieklvplldigdiiidggnseyrdtmrrcrdlkdkgi
lfvgsgvsggedgarygpslmpggnkeawphikaifqgiaakvgtgepccdwvgdd

SCOP Domain Coordinates for d1pgq_2:

Click to download the PDB-style file with coordinates for d1pgq_2.
(The format of our PDB-style files is described here.)

Timeline for d1pgq_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pgq_1