SCOPe 2.06: Domain d1pgpa2: 1pgp A:1-176

Lineage for d1pgpa2 (1pgp A:1-176)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein 6-phosphogluconate dehydrogenase [51871] (2 species)

7. Species Sheep (Ovis orientalis aries) [TaxId:9940] [51872] (5 PDB entries)

8. Domain d1pgpa2: 1pgp A:1-176 [30192]
   Other proteins in same PDB: d1pgpa1
   complexed with 6pg, so4

Details for d1pgpa2

PDB Entry: 1pgp, 2.5 Å

PDB Description: crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for nadp specificity and the enzyme mechanism

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase

SCOPe Domain Sequences for d1pgpa2:

Sequence; same for both SEQRES and ATOM records:

>d1pgpa2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]}
aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvlgahsleem
vsklkkprriillvkagqavdnfieklvplldigdiiidggnseyrdtmrrcrdlkdkgi
lfvgsgvsggedgarygpslmpggnkeawphikaifqgiaakvgtgepccdwvgdd

Timeline for d1pgpa2:

• d1pgpa2 first appeared (with stable ids) in SCOP 1.55, called d1pgp_2
  
• d1pgpa2 appears in SCOPe 2.05
  
• d1pgpa2 appears in SCOPe 2.07
  
• d1pgpa2 appears in the current release, SCOPe 2.08