| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) ![]() |
| Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (12 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
| Protein 6-phosphogluconate dehydrogenase [51871] (2 species) |
| Species Sheep (Ovis orientalis aries) [TaxId:9940] [51872] (5 PDB entries) |
| Domain d1pgp_2: 1pgp 1-176 [30192] Other proteins in same PDB: d1pgp_1 complexed with 6pg, so4 |
PDB Entry: 1pgp (more details), 2.5 Å
SCOP Domain Sequences for d1pgp_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pgp_2 c.2.1.6 (1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries)}
aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvlgahsleem
vsklkkprriillvkagqavdnfieklvplldigdiiidggnseyrdtmrrcrdlkdkgi
lfvgsgvsggedgarygpslmpggnkeawphikaifqgiaakvgtgepccdwvgdd
Timeline for d1pgp_2: