Lineage for d1pgo_2 (1pgo 1-176)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575826Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (15 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 575827Protein 6-phosphogluconate dehydrogenase [51871] (2 species)
  7. 575828Species Sheep (Ovis orientalis aries) [TaxId:9940] [51872] (5 PDB entries)
  8. 575833Domain d1pgo_2: 1pgo 1-176 [30191]
    Other proteins in same PDB: d1pgo_1
    complexed with ndp, so4

Details for d1pgo_2

PDB Entry: 1pgo (more details), 2.5 Å

PDB Description: crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for nadp specificity and the enzyme mechanism

SCOP Domain Sequences for d1pgo_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgo_2 c.2.1.6 (1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries)}
aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvlgahsleem
vsklkkprriillvkagqavdnfieklvplldigdiiidggnseyrdtmrrcrdlkdkgi
lfvgsgvsggedgarygpslmpggnkeawphikaifqgiaakvgtgepccdwvgdd

SCOP Domain Coordinates for d1pgo_2:

Click to download the PDB-style file with coordinates for d1pgo_2.
(The format of our PDB-style files is described here.)

Timeline for d1pgo_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pgo_1