Lineage for d1pgo_2 (1pgo 1-176)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) 
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (6 proteins) 
Protein 6-phosphogluconate dehydrogenase [51871] (2 species) Species Sheep (Ovis orientalis aries) [TaxId:9940] [51872] (5 PDB entries) 
Domain d1pgo_2: 1pgo 1-176 [30191]
Other proteins in same PDB: d1pgo_1
Details for d1pgo_2
PDB Entry: 1pgo (more details), 2.5 Å
PDB Description: crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for nadp specificity and the enzyme mechanism
SCOP Domain Sequences for d1pgo_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pgo_2 c.2.1.6 (1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries)}
aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvlgahsleem
vsklkkprriillvkagqavdnfieklvplldigdiiidggnseyrdtmrrcrdlkdkgi
lfvgsgvsggedgarygpslmpggnkeawphikaifqgiaakvgtgepccdwvgdd
SCOP Domain Coordinates for d1pgo_2:
Click to download the PDB-style file with coordinates for d1pgo_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pgo_2:
- d1pgo_2 appears in SCOP 1.57
- d1pgo_2 appears in the current release, SCOPe 2.08, called d1pgoa2
View in 3D
