Lineage for d2pgda2 (2pgd A:1-176)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2453360Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 2453369Protein 6-phosphogluconate dehydrogenase [51871] (2 species)
  7. 2453370Species Sheep (Ovis orientalis aries) [TaxId:9940] [51872] (5 PDB entries)
  8. 2453371Domain d2pgda2: 2pgd A:1-176 [30190]
    Other proteins in same PDB: d2pgda1
    complexed with so4

Details for d2pgda2

PDB Entry: 2pgd (more details), 2 Å

PDB Description: the structure of 6-phosphogluconate dehydrogenase refined at 2 angstroms resolution
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase

SCOPe Domain Sequences for d2pgda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]}
aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvlgahsleem
vsklkkprriillvkagqavdnfieklvplldigdiiidggnseyrdtmrrcrdlkdkgi
lfvgsgvsggedgarygpslmpggnkeawphikaifqgiaakvgtgepccdwvgdd

SCOPe Domain Coordinates for d2pgda2:

Click to download the PDB-style file with coordinates for d2pgda2.
(The format of our PDB-style files is described here.)

Timeline for d2pgda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pgda1