SCOP 1.65: Domain d2pgd_2: 2pgd 1-176

Lineage for d2pgd_2 (2pgd 1-176)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (12 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein 6-phosphogluconate dehydrogenase [51871] (2 species)

7. Species Sheep (Ovis orientalis aries) [TaxId:9940] [51872] (5 PDB entries)

8. Domain d2pgd_2: 2pgd 1-176 [30190]
   Other proteins in same PDB: d2pgd_1
   complexed with so4

Details for d2pgd_2

PDB Entry: 2pgd, 2 Å

PDB Description: the structure of 6-phosphogluconate dehydrogenase refined at 2 angstroms resolution

SCOP Domain Sequences for d2pgd_2:

Sequence; same for both SEQRES and ATOM records:

>d2pgd_2 c.2.1.6 (1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries)}
aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvlgahsleem
vsklkkprriillvkagqavdnfieklvplldigdiiidggnseyrdtmrrcrdlkdkgi
lfvgsgvsggedgarygpslmpggnkeawphikaifqgiaakvgtgepccdwvgdd

Timeline for d2pgd_2:

• d2pgd_2 first appeared (with stable ids) in SCOP 1.55
  
• d2pgd_2 appears in SCOP 1.63
  
• d2pgd_2 appears in SCOP 1.67
  
• d2pgd_2 appears in the current release, SCOPe 2.08, called d2pgda2