Lineage for d2pgd_2 (2pgd 1-176)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 309007Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (12 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 309008Protein 6-phosphogluconate dehydrogenase [51871] (2 species)
  7. 309009Species Sheep (Ovis orientalis aries) [TaxId:9940] [51872] (5 PDB entries)
  8. 309010Domain d2pgd_2: 2pgd 1-176 [30190]
    Other proteins in same PDB: d2pgd_1
    complexed with so4

Details for d2pgd_2

PDB Entry: 2pgd (more details), 2 Å

PDB Description: the structure of 6-phosphogluconate dehydrogenase refined at 2 angstroms resolution

SCOP Domain Sequences for d2pgd_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pgd_2 c.2.1.6 (1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries)}
aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvlgahsleem
vsklkkprriillvkagqavdnfieklvplldigdiiidggnseyrdtmrrcrdlkdkgi
lfvgsgvsggedgarygpslmpggnkeawphikaifqgiaakvgtgepccdwvgdd

SCOP Domain Coordinates for d2pgd_2:

Click to download the PDB-style file with coordinates for d2pgd_2.
(The format of our PDB-style files is described here.)

Timeline for d2pgd_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pgd_1