Lineage for d1yvel2 (1yve L:83-307)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 821720Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 821740Protein Class II ketol-acid reductoisomerase (KARI) [51869] (1 species)
    contains additional subdomain at the N-terminus, partly ordered
  7. 821741Species Spinach (Spinacia oleracea) [TaxId:3562] [51870] (2 PDB entries)
  8. 821749Domain d1yvel2: 1yve L:83-307 [30189]
    Other proteins in same PDB: d1yvei1, d1yvej1, d1yvek1, d1yvel1
    complexed with cl, hio, mg, ndp

Details for d1yvel2

PDB Entry: 1yve (more details), 1.65 Å

PDB Description: acetohydroxy acid isomeroreductase complexed with nadph, magnesium and inhibitor ipoha (n-hydroxy-n-isopropyloxamate)
PDB Compounds: (L:) acetohydroxy acid isomeroreductase

SCOP Domain Sequences for d1yvel2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvel2 c.2.1.6 (L:83-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]}
attfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvigwgsqapaqaq
nlkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetisgsdlvlllisd
saqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcpkgmgpsvrrly
vqgkevngaginssfavhqdvdgratdvalgwsialgspftfatt

SCOP Domain Coordinates for d1yvel2:

Click to download the PDB-style file with coordinates for d1yvel2.
(The format of our PDB-style files is described here.)

Timeline for d1yvel2: