Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
Protein Class II ketol-acid reductoisomerase (KARI) [51869] (1 species) contains additional subdomain at the N-terminus, partly ordered |
Species Spinach (Spinacia oleracea) [TaxId:3562] [51870] (2 PDB entries) |
Domain d1yvel2: 1yve L:83-307 [30189] Other proteins in same PDB: d1yvei1, d1yvej1, d1yvek1, d1yvel1 complexed with cl, hio, mg, ndp |
PDB Entry: 1yve (more details), 1.65 Å
SCOP Domain Sequences for d1yvel2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvel2 c.2.1.6 (L:83-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} attfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvigwgsqapaqaq nlkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetisgsdlvlllisd saqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcpkgmgpsvrrly vqgkevngaginssfavhqdvdgratdvalgwsialgspftfatt
Timeline for d1yvel2: