Lineage for d1yvej2 (1yve J:86-307)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20614Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (6 proteins)
  6. 20625Protein Acetohydroxy acid isomeroreductase, ketoacid reductoisomerase (KARI) [51869] (1 species)
  7. 20626Species Spinach (Spinacia oleracea) [TaxId:3562] [51870] (2 PDB entries)
  8. 20632Domain d1yvej2: 1yve J:86-307 [30187]
    Other proteins in same PDB: d1yvei1, d1yvej1, d1yvek1, d1yvel1

Details for d1yvej2

PDB Entry: 1yve (more details), 1.65 Å

PDB Description: acetohydroxy acid isomeroreductase complexed with nadph, magnesium and inhibitor ipoha (n-hydroxy-n-isopropyloxamate)

SCOP Domain Sequences for d1yvej2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvej2 c.2.1.6 (J:86-307) Acetohydroxy acid isomeroreductase, ketoacid reductoisomerase (KARI) {Spinach (Spinacia oleracea)}
fdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvigwgsqapaqaqnlk
dslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetisgsdlvlllisdsaq
adnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcpkgmgpsvrrlyvqg
kevngaginssfavhqdvdgratdvalgwsialgspftfatt

SCOP Domain Coordinates for d1yvej2:

Click to download the PDB-style file with coordinates for d1yvej2.
(The format of our PDB-style files is described here.)

Timeline for d1yvej2: