| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
| Protein Class II ketol-acid reductoisomerase (KARI) [51869] (1 species) contains additional subdomain at the N-terminus, partly ordered |
| Species Spinach (Spinacia oleracea) [TaxId:3562] [51870] (2 PDB entries) |
| Domain d1yvej2: 1yve J:86-307 [30187] Other proteins in same PDB: d1yvei1, d1yvej1, d1yvek1, d1yvel1 complexed with cl, hio, mg, ndp |
PDB Entry: 1yve (more details), 1.65 Å
SCOPe Domain Sequences for d1yvej2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvej2 c.2.1.6 (J:86-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]}
fdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvigwgsqapaqaqnlk
dslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetisgsdlvlllisdsaq
adnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcpkgmgpsvrrlyvqg
kevngaginssfavhqdvdgratdvalgwsialgspftfatt
Timeline for d1yvej2: