SCOPe 2.08: Domain d1yvei2: 1yve I:83-307

Lineage for d1yvei2 (1yve I:83-307)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Class II ketol-acid reductoisomerase (KARI) [51869] (1 species)
   contains additional subdomain at the N-terminus, partly ordered

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [51870] (2 PDB entries)

8. Domain d1yvei2: 1yve I:83-307 [30186]
   Other proteins in same PDB: d1yvei1, d1yvej1, d1yvek1, d1yvel1
   complexed with cl, hio, mg, ndp

Details for d1yvei2

PDB Entry: 1yve, 1.65 Å

PDB Description: acetohydroxy acid isomeroreductase complexed with nadph, magnesium and inhibitor ipoha (n-hydroxy-n-isopropyloxamate)

PDB Compounds: (I:) acetohydroxy acid isomeroreductase

SCOPe Domain Sequences for d1yvei2:

Sequence; same for both SEQRES and ATOM records:

>d1yvei2 c.2.1.6 (I:83-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]}
attfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvigwgsqapaqaq
nlkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetisgsdlvlllisd
saqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcpkgmgpsvrrly
vqgkevngaginssfavhqdvdgratdvalgwsialgspftfatt

Timeline for d1yvei2:

• d1yvei2 first appeared (with stable ids) in SCOP 1.55
  
• d1yvei2 appears in SCOPe 2.07