SCOP 1.71: Domain d1qmgd2: 1qmg D:83-307

Lineage for d1qmgd2 (1qmg D:83-307)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (15 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Class II ketol-acid reductoisomerase (KARI) [51869] (1 species)
   contains additional subdomain at the N-terminus, partly ordered

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [51870] (2 PDB entries)

8. Domain d1qmgd2: 1qmg D:83-307 [30185]
   Other proteins in same PDB: d1qmga1, d1qmgb1, d1qmgc1, d1qmgd1
   complexed with apx, dmv, mn, so4

Details for d1qmgd2

PDB Entry: 1qmg, 1.6 Å

PDB Description: acetohydroxyacid isomeroreductase complexed with its reaction product dihydroxy-methylvalerate, manganese and adp-ribose.

SCOP Domain Sequences for d1qmgd2:

Sequence; same for both SEQRES and ATOM records:

>d1qmgd2 c.2.1.6 (D:83-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea)}
attfdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvigwgsqapaqaq
nlkdslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetisgsdlvlllisd
saqadnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcpkgmgpsvrrly
vqgkevngaginssfavhqdvdgratdvalgwsialgspftfatt

Timeline for d1qmgd2:

• d1qmgd2 first appeared (with stable ids) in SCOP 1.55
  
• d1qmgd2 appears in SCOP 1.69
  
• d1qmgd2 appears in SCOP 1.73
  
• d1qmgd2 appears in the current release, SCOPe 2.08