SCOPe 2.05: Domain d1qmgb2: 1qmg B:86-307

Lineage for d1qmgb2 (1qmg B:86-307)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Class II ketol-acid reductoisomerase (KARI) [51869] (1 species)
   contains additional subdomain at the N-terminus, partly ordered

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [51870] (2 PDB entries)

8. Domain d1qmgb2: 1qmg B:86-307 [30183]
   Other proteins in same PDB: d1qmga1, d1qmgb1, d1qmgc1, d1qmgd1
   complexed with apx, dmv, mn, so4

Details for d1qmgb2

PDB Entry: 1qmg, 1.6 Å

PDB Description: acetohydroxyacid isomeroreductase complexed with its reaction product dihydroxy-methylvalerate, manganese and adp-ribose.

PDB Compounds: (B:) acetohydroxy-acid isomeroreductase

SCOPe Domain Sequences for d1qmgb2:

Sequence; same for both SEQRES and ATOM records:

>d1qmgb2 c.2.1.6 (B:86-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]}
fdfdssvfkkekvtlsghdeyivrggrnlfpllpdafkgikqigvigwgsqapaqaqnlk
dslteaksdvvvkiglrkgsnsfaearaagfseengtlgdmwetisgsdlvlllisdsaq
adnyekvfshmkpnsilglshgfllghlqslgqdfpknisviavcpkgmgpsvrrlyvqg
kevngaginssfavhqdvdgratdvalgwsialgspftfatt

Timeline for d1qmgb2:

• d1qmgb2 first appeared (with stable ids) in SCOP 1.55
  
• d1qmgb2 appears in SCOPe 2.04
  
• d1qmgb2 appears in SCOPe 2.06
  
• d1qmgb2 appears in the current release, SCOPe 2.08