| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily) Core: 3 helices; irregular array; disulfide-rich |
Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) ![]() automatically mapped to Pfam PF01392 |
| Family a.141.1.0: automated matches [274414] (1 protein) not a true family |
| Protein automated matches [274417] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [274420] (11 PDB entries) |
| Domain d5bpbb1: 5bpb B:44-165 [301829] Other proteins in same PDB: d5bpbb2 automated match to d5bpbd_ complexed with nag |
PDB Entry: 5bpb (more details), 2.2 Å
SCOPe Domain Sequences for d5bpbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bpbb1 a.141.1.0 (B:44-165) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyv
pmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegpg
de
Timeline for d5bpbb1: