SCOPe 2.07: Domain d1lldb1: 1lld B:7-149

Lineage for d1lldb1 (1lld B:7-149)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (19 species)

7. Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [51866] (2 PDB entries)

8. Domain d1lldb1: 1lld B:7-149 [30178]
   Other proteins in same PDB: d1llda2, d1lldb2
   complexed with nad

Details for d1lldb1

PDB Entry: 1lld, 2 Å

PDB Description: molecular basis of allosteric activation of bacterial l-lactate dehydrogenase

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1lldb1:

Sequence; same for both SEQRES and ATOM records:

>d1lldb1 c.2.1.5 (B:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]}
ptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyptvsidg
sddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiymlitnp
vdiathvaqkltglpenqifgsg

Timeline for d1lldb1:

• d1lldb1 first appeared (with stable ids) in SCOP 1.55
  
• d1lldb1 appears in SCOPe 2.06
  
• d1lldb1 appears in the current release, SCOPe 2.08