![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) ![]() |
![]() | Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (3 proteins) |
![]() | Protein Lactate dehydrogenase [51859] (8 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries) |
![]() | Domain d1ldnh1: 1ldn H:15-162 [30173] Other proteins in same PDB: d1ldna2, d1ldnb2, d1ldnc2, d1ldnd2, d1ldne2, d1ldnf2, d1ldng2, d1ldnh2 |
PDB Entry: 1ldn (more details), 2.5 Å
SCOP Domain Sequences for d1ldnh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldnh1 c.2.1.5 (H:15-162) Lactate dehydrogenase {Bacillus stearothermophilus} mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl vatnpvdiltyatwkfsglphervigsg
Timeline for d1ldnh1: