SCOPe 2.08: Domain d1ldnh1: 1ldn H:15-162

Lineage for d1ldnh1 (1ldn H:15-162)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (19 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries)

8. Domain d1ldnh1: 1ldn H:15-162 [30173]
   Other proteins in same PDB: d1ldna2, d1ldnb2, d1ldnc2, d1ldnd2, d1ldne2, d1ldnf2, d1ldng2, d1ldnh2
   complexed with fbp, nad, oxm

Details for d1ldnh1

PDB Entry: 1ldn, 2.5 Å

PDB Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution

PDB Compounds: (H:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1ldnh1:

Sequence; same for both SEQRES and ATOM records:

>d1ldnh1 c.2.1.5 (H:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
vatnpvdiltyatwkfsglphervigsg

Timeline for d1ldnh1:

• d1ldnh1 first appeared (with stable ids) in SCOP 1.55
  
• d1ldnh1 appears in SCOPe 2.07