Lineage for d4zncf2 (4znc F:342-444)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757116Domain d4zncf2: 4znc F:342-444 [301704]
    Other proteins in same PDB: d4znca_, d4zncb_, d4zncc_
    automated match to d4hafa2
    mutant

Details for d4zncf2

PDB Entry: 4znc (more details), 2.28 Å

PDB Description: fc fragment of human igg in complex with the c domain of staphylococcal protein a mutant - q9w
PDB Compounds: (F:) Ig gamma-3 chain C region

SCOPe Domain Sequences for d4zncf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zncf2 b.1.1.0 (F:342-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewessgqpennynttppmldsd
gsfflyskltvdksrwqqgnifscsvmhealhnhytqkslsls

SCOPe Domain Coordinates for d4zncf2:

Click to download the PDB-style file with coordinates for d4zncf2.
(The format of our PDB-style files is described here.)

Timeline for d4zncf2: