Lineage for d4zncf1 (4znc F:240-341)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367665Domain d4zncf1: 4znc F:240-341 [301703]
    Other proteins in same PDB: d4znca_, d4zncb_, d4zncc_
    automated match to d4hafa1
    mutant

Details for d4zncf1

PDB Entry: 4znc (more details), 2.28 Å

PDB Description: fc fragment of human igg in complex with the c domain of staphylococcal protein a mutant - q9w
PDB Compounds: (F:) Ig gamma-3 chain C region

SCOPe Domain Sequences for d4zncf1:

Sequence, based on SEQRES records: (download)

>d4zncf1 b.1.1.0 (F:240-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpreeqfnst
frvvsvltvlhqdwlngkeykckvsnkalpapiektisktkg

Sequence, based on observed residues (ATOM records): (download)

>d4zncf1 b.1.1.0 (F:240-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpvvsvltvl
hqdwlngkeykckvsnkalpapiektisktkg

SCOPe Domain Coordinates for d4zncf1:

Click to download the PDB-style file with coordinates for d4zncf1.
(The format of our PDB-style files is described here.)

Timeline for d4zncf1: