SCOPe 2.08: Domain d4zncf1: 4znc F:240-341

Lineage for d4zncf1 (4znc F:240-341)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4zncf1: 4znc F:240-341 [301703]
   Other proteins in same PDB: d4znca_, d4zncb_, d4zncc_
   automated match to d4hafa1
   mutant

Details for d4zncf1

PDB Entry: 4znc, 2.28 Å

PDB Description: fc fragment of human igg in complex with the c domain of staphylococcal protein a mutant - q9w

PDB Compounds: (F:) Ig gamma-3 chain C region

SCOPe Domain Sequences for d4zncf1:

Sequence, based on SEQRES records:

>d4zncf1 b.1.1.0 (F:240-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpreeqfnst
frvvsvltvlhqdwlngkeykckvsnkalpapiektisktkg

Sequence, based on observed residues (ATOM records):

>d4zncf1 b.1.1.0 (F:240-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpvvsvltvl
hqdwlngkeykckvsnkalpapiektisktkg

Timeline for d4zncf1:

• d4zncf1 first appeared in SCOPe 2.06
  
• d4zncf1 appears in SCOPe 2.07