Lineage for d1ldnc1 (1ldn C:15-162)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1829377Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1829416Protein Lactate dehydrogenase [51859] (17 species)
  7. 1829417Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries)
  8. 1829420Domain d1ldnc1: 1ldn C:15-162 [30168]
    Other proteins in same PDB: d1ldna2, d1ldnb2, d1ldnc2, d1ldnd2, d1ldne2, d1ldnf2, d1ldng2, d1ldnh2
    complexed with fbp, nad, oxm

Details for d1ldnc1

PDB Entry: 1ldn (more details), 2.5 Å

PDB Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution
PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1ldnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldnc1 c.2.1.5 (C:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
vatnpvdiltyatwkfsglphervigsg

SCOPe Domain Coordinates for d1ldnc1:

Click to download the PDB-style file with coordinates for d1ldnc1.
(The format of our PDB-style files is described here.)

Timeline for d1ldnc1: