Lineage for d8ldha1 (8ldh A:1-160)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1579036Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1579075Protein Lactate dehydrogenase [51859] (18 species)
  7. 1579111Species Dogfish (Squalus acanthias) [TaxId:7797] [51862] (3 PDB entries)
  8. 1579114Domain d8ldha1: 8ldh A:1-160 [30162]
    Other proteins in same PDB: d8ldha2
    complexed with cit

Details for d8ldha1

PDB Entry: 8ldh (more details), 2.8 Å

PDB Description: refined crystal structure of dogfish m4 apo-lactate dehydrogenase
PDB Compounds: (A:) m4 apo-lactate dehydrogenase

SCOPe Domain Sequences for d8ldha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8ldha1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]}
atlkdklighlatsqeprsynkitvvgvgavgmacaisilmkdladevalvdvmedklkg
emmdlqhgslflhtakivsgkdysvsagsklvvitagarqqegesrlnlvqrnvnifkfi
ipnivkhspdciilvvsnpvdvltyvawklsglpmhriig

SCOPe Domain Coordinates for d8ldha1:

Click to download the PDB-style file with coordinates for d8ldha1.
(The format of our PDB-style files is described here.)

Timeline for d8ldha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d8ldha2