SCOP 1.71: Domain d8ldh_1: 8ldh 1-160

Lineage for d8ldh_1 (8ldh 1-160)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)

6. Protein Lactate dehydrogenase [51859] (14 species)

7. Species Dogfish (Squalus acanthias) [TaxId:7797] [51862] (3 PDB entries)

8. Domain d8ldh_1: 8ldh 1-160 [30162]
   Other proteins in same PDB: d8ldh_2
   complexed with cit

Details for d8ldh_1

PDB Entry: 8ldh, 2.8 Å

PDB Description: refined crystal structure of dogfish m4 apo-lactate dehydrogenase

SCOP Domain Sequences for d8ldh_1:

Sequence; same for both SEQRES and ATOM records:

>d8ldh_1 c.2.1.5 (1-160) Lactate dehydrogenase {Dogfish (Squalus acanthias)}
atlkdklighlatsqeprsynkitvvgvgavgmacaisilmkdladevalvdvmedklkg
emmdlqhgslflhtakivsgkdysvsagsklvvitagarqqegesrlnlvqrnvnifkfi
ipnivkhspdciilvvsnpvdvltyvawklsglpmhriig

Timeline for d8ldh_1:

• d8ldh_1 first appeared (with stable ids) in SCOP 1.55
  
• d8ldh_1 appears in SCOP 1.69
  
• d8ldh_1 is called d8ldha1 in SCOP 1.73
  
• d8ldh_1 appears in the current release, SCOPe 2.08, called d8ldha1