| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226685] (10 PDB entries) |
| Domain d4zb7b1: 4zb7 B:4-94 [301618] automated match to d4zbaa1 complexed with gol, so4 |
PDB Entry: 4zb7 (more details), 2.4 Å
SCOPe Domain Sequences for d4zb7b1:
Sequence, based on SEQRES records: (download)
>d4zb7b1 c.47.1.0 (B:4-94) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
gkqftlythkggpngwkvtivleelgltyesifldfqkgehkapeylkvnpngripalid
hknndytvwesnaiiqylvdkydkdrkvsva
>d4zb7b1 c.47.1.0 (B:4-94) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
gkqftlythkggpngwkvtivleelgltyesifldripalidhknndytvwesnaiiqyl
vdkydkdrkvsva
Timeline for d4zb7b1: