Lineage for d4zb7b1 (4zb7 B:4-94)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879185Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226685] (10 PDB entries)
  8. 2879205Domain d4zb7b1: 4zb7 B:4-94 [301618]
    automated match to d4zbaa1
    complexed with gol, so4

Details for d4zb7b1

PDB Entry: 4zb7 (more details), 2.4 Å

PDB Description: phanerochaete chrysosporium ure2p6 in apo form.
PDB Compounds: (B:) PcUre2p6

SCOPe Domain Sequences for d4zb7b1:

Sequence, based on SEQRES records: (download)

>d4zb7b1 c.47.1.0 (B:4-94) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
gkqftlythkggpngwkvtivleelgltyesifldfqkgehkapeylkvnpngripalid
hknndytvwesnaiiqylvdkydkdrkvsva

Sequence, based on observed residues (ATOM records): (download)

>d4zb7b1 c.47.1.0 (B:4-94) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
gkqftlythkggpngwkvtivleelgltyesifldripalidhknndytvwesnaiiqyl
vdkydkdrkvsva

SCOPe Domain Coordinates for d4zb7b1:

Click to download the PDB-style file with coordinates for d4zb7b1.
(The format of our PDB-style files is described here.)

Timeline for d4zb7b1: