Lineage for d4z7sl1 (4z7s L:1-107)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2035316Domain d4z7sl1: 4z7s L:1-107 [301603]
    Other proteins in same PDB: d4z7sa_, d4z7sc_, d4z7sf2, d4z7sl2
    automated match to d1a5fl1
    complexed with 4m3, bma, ca, cl, gol, man, mg, nag, so4

Details for d4z7sl1

PDB Entry: 4z7s (more details), 2.7 Å

PDB Description: integrin alphaiibbeta3 in complex with ro-435054
PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d4z7sl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7sl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik

SCOPe Domain Coordinates for d4z7sl1:

Click to download the PDB-style file with coordinates for d4z7sl1.
(The format of our PDB-style files is described here.)

Timeline for d4z7sl1:

  • d4z7sl1 is new in SCOPe 2.06-stable
  • d4z7sl1 does not appear in SCOPe 2.07