Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries) |
Domain d4z7sl1: 4z7s L:1-107 [301603] Other proteins in same PDB: d4z7sa_, d4z7sc_, d4z7sf2, d4z7sl2 automated match to d1a5fl1 complexed with 4m3, bma, ca, cl, gol, man, mg, nag, so4 |
PDB Entry: 4z7s (more details), 2.7 Å
SCOPe Domain Sequences for d4z7sl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z7sl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik
Timeline for d4z7sl1:
View in 3D Domains from other chains: (mouse over for more information) d4z7sa_, d4z7sc_, d4z7sf1, d4z7sf2 |