SCOP 1.73: Domain d2ldxa1: 2ldx A:1-159

Lineage for d2ldxa1 (2ldx A:1-159)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)

6. Protein Lactate dehydrogenase [51859] (14 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [51861] (1 PDB entry)

8. Domain d2ldxa1: 2ldx A:1-159 [30159]
   Other proteins in same PDB: d2ldxa2, d2ldxb2, d2ldxc2, d2ldxd2

Details for d2ldxa1

PDB Entry: 2ldx, 2.96 Å

PDB Description: characterization of the antigenic sites on the refined 3-angstroms resolution structure of mouse testicular lactate dehydrogenase c4

PDB Compounds: (A:) apo-lactate dehydrogenase

SCOP Domain Sequences for d2ldxa1:

Sequence; same for both SEQRES and ATOM records:

>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]}
stvkeqliqnlvpedklsrckitvvgvgdvgmacaisillkgladelalvdadtdklrge
aldlqhgslflstpkivfgkdynvsansklviitagarmvsgqtrldllqrnvaimkaiv
pgviqnspdckiivvtnpvdiltyvvwkisgfpvgrvig

Timeline for d2ldxa1:

• d2ldxa1 first appeared (with stable ids) in SCOP 1.55, called d2ldx_1
  
• d2ldxa1 was called d2ldx_1 in SCOP 1.71
  
• d2ldxa1 appears in SCOP 1.75
  
• d2ldxa1 appears in the current release, SCOPe 2.08