Lineage for d2ldx_1 (2ldx 1-159)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66781Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 66788Protein Lactate dehydrogenase [51859] (10 species)
  7. 66827Species Mouse (Mus musculus) [TaxId:10090] [51861] (1 PDB entry)
  8. 66828Domain d2ldx_1: 2ldx 1-159 [30159]
    Other proteins in same PDB: d2ldx_2

Details for d2ldx_1

PDB Entry: 2ldx (more details), 2.96 Å

PDB Description: characterization of the antigenic sites on the refined 3-angstroms resolution structure of mouse testicular lactate dehydrogenase c4

SCOP Domain Sequences for d2ldx_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ldx_1 c.2.1.5 (1-159) Lactate dehydrogenase {Mouse (Mus musculus)}
stvkeqliqnlvpedklsrckitvvgvgdvgmacaisillkgladelalvdadtdklrge
aldlqhgslflstpkivfgkdynvsansklviitagarmvsgqtrldllqrnvaimkaiv
pgviqnspdckiivvtnpvdiltyvvwkisgfpvgrvig

SCOP Domain Coordinates for d2ldx_1:

Click to download the PDB-style file with coordinates for d2ldx_1.
(The format of our PDB-style files is described here.)

Timeline for d2ldx_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ldx_2