SCOPe 2.03: Domain d5ldha1: 5ldh A:1-162

Lineage for d5ldha1 (5ldh A:1-162)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (17 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51860] (3 PDB entries)

8. Domain d5ldha1: 5ldh A:1-162 [30158]
   Other proteins in same PDB: d5ldha2, d5ldhb2
   complexed with cit, lnc

Details for d5ldha1

PDB Entry: 5ldh, 2.7 Å

PDB Description: structure of the active ternary complex of pig heart lactate dehydrogenase with s-lac-nad at 2.7 angstroms resolution

PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d5ldha1:

Sequence; same for both SEQRES and ATOM records:

>d5ldha1 c.2.1.5 (A:1-162) Lactate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
atlkekliapvaqqettipdnkitvvgvgqvgmacaisilgksltdelalvdvledklkg
emmdlqhgslflqtpkivankdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
ipqivkyspnciiivvsnpvdiltyvawklsglpkhrvig

Timeline for d5ldha1:

• d5ldha1 first appeared (with stable ids) in SCOP 1.55, called d5ldh_1
  
• d5ldha1 appears in SCOPe 2.02
  
• d5ldha1 appears in SCOPe 2.04
  
• d5ldha1 appears in the current release, SCOPe 2.08