Lineage for d5ldh_1 (5ldh 1-162)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 478258Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 478281Protein Lactate dehydrogenase [51859] (13 species)
  7. 478337Species Pig (Sus scrofa) [TaxId:9823] [51860] (3 PDB entries)
  8. 478342Domain d5ldh_1: 5ldh 1-162 [30158]
    Other proteins in same PDB: d5ldh_2

Details for d5ldh_1

PDB Entry: 5ldh (more details), 2.7 Å

PDB Description: structure of the active ternary complex of pig heart lactate dehydrogenase with s-lac-nad at 2.7 angstroms resolution

SCOP Domain Sequences for d5ldh_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ldh_1 c.2.1.5 (1-162) Lactate dehydrogenase {Pig (Sus scrofa)}
atlkekliapvaqqettipdnkitvvgvgqvgmacaisilgksltdelalvdvledklkg
emmdlqhgslflqtpkivankdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
ipqivkyspnciiivvsnpvdiltyvawklsglpkhrvig

SCOP Domain Coordinates for d5ldh_1:

Click to download the PDB-style file with coordinates for d5ldh_1.
(The format of our PDB-style files is described here.)

Timeline for d5ldh_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ldh_2