| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Lactate dehydrogenase [51859] (19 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [51860] (3 PDB entries) |
| Domain d5ldha1: 5ldh A:1-162 [30158] Other proteins in same PDB: d5ldha2, d5ldhb2 complexed with cit, lnc |
PDB Entry: 5ldh (more details), 2.7 Å
SCOPe Domain Sequences for d5ldha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ldha1 c.2.1.5 (A:1-162) Lactate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
atlkekliapvaqqettipdnkitvvgvgqvgmacaisilgksltdelalvdvledklkg
emmdlqhgslflqtpkivankdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
ipqivkyspnciiivvsnpvdiltyvawklsglpkhrvig
Timeline for d5ldha1: