SCOPe 2.07: Domain d1b8ua1: 1b8u A:3-158

Lineage for d1b8ua1 (1b8u A:3-158)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Malate dehydrogenase [51849] (13 species)

7. Species Aquaspirillum arcticum [TaxId:87645] [51856] (3 PDB entries)

8. Domain d1b8ua1: 1b8u A:3-158 [30149]
   Other proteins in same PDB: d1b8ua2
   complexed with nad, oaa

Details for d1b8ua1

PDB Entry: 1b8u, 2.5 Å

PDB Description: malate dehydrogenase from aquaspirillum arcticum

PDB Compounds: (A:) protein (malate dehydrogenase)

SCOPe Domain Sequences for d1b8ua1:

Sequence; same for both SEQRES and ATOM records:

>d1b8ua1 c.2.1.5 (A:3-158) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]}
ktpmrvavtgaagqicysllfriangdmlgkdqpvilqlleipnekaqkalqgvmmeidd
cafpllagmtahadpmtafkdadvallvgarprgpgmerkdlleanaqiftvqgkaidav
asrnikvlvvgnpantnayiamksapslpaknftam

Timeline for d1b8ua1:

• d1b8ua1 first appeared (with stable ids) in SCOP 1.55
  
• d1b8ua1 appears in SCOPe 2.06
  
• d1b8ua1 appears in the current release, SCOPe 2.08